PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.J00154.1.p
Common NameLOC105952807, MIMGU_mgv1a019052mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family Trihelix
Protein Properties Length: 294aa    MW: 34294.7 Da    PI: 8.1165
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.J00154.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix76.25.1e-2432114186
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                       +W+ qe+++ + +r e++ ++ ++k++k lWe +s +m+e+g+ rsp qCk+kw+nl +r+k ++++e ++    ++++p++++l+
  Migut.J00154.1.p  32 QWSIQETRDFLIIRAELDPAFMETKRNKLLWEVISTRMKEKGYIRSPDQCKCKWKNLVTRFKGCETMEAEG---MRQQFPFYNELQ 114
                       7********************************************************************97...56679****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122031.10E-223196No hitNo description
PfamPF138373.8E-1832115No hitNo description
PROSITE profilePS500906.8063389IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MDQGHHHHHQ GQVHHHFSVS NIDPGGGDRF PQWSIQETRD FLIIRAELDP AFMETKRNKL  60
LWEVISTRMK EKGYIRSPDQ CKCKWKNLVT RFKGCETMEA EGMRQQFPFY NELQTIFAAR  120
MQRMLWLEAE GGGGGGGAAA ASSSKKKTTA QFSSDDEEEN EDQISEGEKA KKKRKLKGTI  180
HNNPQSSTTG INSAAAAVIN GVKEIMEEYM KQQMQMETQW LKAYEMREEE RRVKEMEWRQ  240
TMEALENERI MMDRRWRERE EQRKIREEAR ADKRDALITA LLNKLRRSED NVQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A7e-1429112386DNA binding protein GT-1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1170175KKKRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012831841.10.0PREDICTED: trihelix transcription factor GT-3b
SwissprotO804501e-69TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLA0A022RPD30.0A0A022RPD3_ERYGU; Uncharacterized protein
STRINGGLYMA18G43190.21e-104(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41872343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.14e-53Trihelix family protein